PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK18087.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 157aa    MW: 18114.6 Da    PI: 8.3644
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK18087.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS141.96.7e-444155224374
       GRAS 224 rdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                 ++++k+v++l+P v+vv+e ea+hns+ F++rf+eal +y a fd+le+ + re+e+r++ E  ++g  i+n+va eg++r+ rh t   W++ +++ G
  PK18087.2   4 LESLVKVVRNLNPCVMVVTEIEANHNSPVFVNRFIEALFFYGAYFDCLENFMKREDENRMVCESLYFGTGIKNMVASEGKQRKIRHVTIDVWKAFFTRYG 103
                56799*********************************************************************************************** PP

       GRAS 324 Fkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                Fk v+ls++   qakl+l+k++ ++  +++ + ++l+ gWk+ p++s+S+W+
  PK18087.2 104 FKDVELSSSSLYQAKLILKKFScEHSCTLDLNGKCLIVGWKGTPILSLSVWK 155
                **********************9999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098520.3791134IPR005202Transcription factor GRAS
PfamPF035142.3E-414155IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
XDQLESLVKV VRNLNPCVMV VTEIEANHNS PVFVNRFIEA LFFYGAYFDC LENFMKREDE  60
NRMVCESLYF GTGIKNMVAS EGKQRKIRHV TIDVWKAFFT RYGFKDVELS SSSLYQAKLI  120
LKKFSCEHSC TLDLNGKCLI VGWKGTPILS LSVWKIX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-177155225375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010097794.11e-82hypothetical protein L484_004208
TrEMBLW9RU082e-82W9RU08_9R
STRINGPGSC0003DMT4000698452e-64(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47933162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-31RGA-like 2